PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.2637s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 581aa    MW: 62383 Da    PI: 7.5985
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.2637s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.7e-093784102254
                          SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          ++yp+ +++  LAk++gL+ +qV++WF N R +
  Cagra.2637s0010.1.p 378 HPYPTDTDKLMLAKQTGLSRNQVSNWFINARVR 410
                          89*****************************87 PP

2BELL112.52.2e-36232300472
                 BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          ++ kkk+kL+s+l+eV+krYkqy+eqlq+v++sFe+vaglg+a+pY++lAlka+S+hF+cLk+ai++q+
  Cagra.2637s0010.1.p 232 DNGKKKSKLISMLDEVYKRYKQYYEQLQAVMGSFECVAGLGHAAPYATLALKALSKHFKCLKNAITDQL 300
                          5789**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.5E-69172298IPR006563POX domain
PfamPF075263.0E-34177297IPR006563POX domain
SMARTSM003894.0E-9354418IPR001356Homeobox domain
CDDcd000862.05E-11354415No hitNo description
SuperFamilySSF466899.84E-17356421IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-27358418IPR009057Homeodomain-like
PfamPF059201.8E-18371410IPR008422Homeobox KN domain
PROSITE profilePS5007111.645373414IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MADAYEPYHV LQQSRRDKLR IPSLDSHFHF HPPPPPPSSS SGGGGGGSGV FPLADSDFLA  60
AGGFHSNNNN NNHMSNPSYS NFMGFLGGPS SSSSTAVAVA GDHSFNAGLS SGDVLVFKPE  120
PLSLSLSSHP RLAYDLLVPG VVNSGFCRSA GDANAGAVTV ASRSSGPLGP FTGYASILKG  180
SRFLKPAQML LDEFCNVGRG IYTDKVIDDD DSSLLFDPTV ENLCGVSDGG GDNGKKKSKL  240
ISMLDEVYKR YKQYYEQLQA VMGSFECVAG LGHAAPYATL ALKALSKHFK CLKNAITDQL  300
QFSHDNKIQQ QQCGHPMNSE NKTDSLRFGG SDSSRGFCSA GQRHGFPDHH APVWRPHRGL  360
PERAVTVLRA WLFDHFLHPY PTDTDKLMLA KQTGLSRNQV SNWFINARVR VWKPMVEEIH  420
MLETRQTQRS SSSSWRDERS STTVFPDNNN PSSSAAHQRA NNSSPARRAR NDDVHGTTDN  480
NSYVNTGSGN AVGFSYGIGS SNVPVMSNST NGGVSLTLGL HHQIGLPEPF PMTTAQRFGL  540
DGGSGDGGGH GGGGYEGQNR QFGRDFIGGS NHQFLHDFVG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A5e-17360418563Homeobox protein Meis2
4xrm_B5e-17360418563Homeobox protein Meis2
5bng_A5e-17360418159Homeobox protein Meis2
5bng_B5e-17360418159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0205370.0BT020537.1 Arabidopsis thaliana At5g02030 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006287258.10.0hypothetical protein CARUB_v10000448mg
SwissprotQ9LZM80.0BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLR0FE520.0R0FE52_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.6__114__AT5G02030.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56882746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.10.0TALE family protein